PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA007657-PA
Common NameOsI_06081
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family CO-like
Protein Properties Length: 347aa    MW: 35463.8 Da    PI: 6.8244
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA007657-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box22.62.2e-0757101341
          zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41 
                        ++C+ +e  ++   C+ +   lC+ C + +H        H++vp
  BGIOSGA007657-PA  57 VWVCEVCELAPAAVTCKADAAALCAACDSDIHDAnplarrHERVP 101
                       689*****************************4477888898876 PP

2CCT69.58.5e-24279322144
               CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                       R+a+l+RY+eKrk+R+FeK+irY+sRKa+Ae+RpRvKGrF+k+a
  BGIOSGA007657-PA 279 RAARLMRYREKRKNRRFEKTIRYASRKAYAETRPRVKGRFAKRA 322
                       99****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003360.041159IPR000315B-box-type zinc finger
PROSITE profilePS5011910.09655102IPR000315B-box-type zinc finger
PfamPF006433.4E-556101IPR000315B-box-type zinc finger
SMARTSM003365.2E-760102IPR000315B-box-type zinc finger
PfamPF062031.0E-17279321IPR010402CCT domain
PROSITE profilePS5101716.807279321IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MELGLGRYWG VGGRRCGACA VAPAAVHCRT CDGGGGGGGY LCAGCDAEHG RAGHERVWVC  60
EVCELAPAAV TCKADAAALC AACDSDIHDA NPLARRHERV PGHPIGSSAA PPPDALLLGG  120
ENDAAAAVDG GGGGKEVKLD FLFADFMDPY LGGSPELARF PHADSVVPNH NGSAGPAMEL  180
GFAGGGGAAV KPSYSSYTAA SLGNSGSSSE VGLVPDAICG GGGGGIIELD FAQSKAAYLP  240
YASTPSHSMS SSMDMGVAAP EMSDGAAAAA GRAYAAEGRA ARLMRYREKR KNRRFEKTIR  300
YASRKAYAET RPRVKGRFAK RADDHDAAAP PPQIMLDFAG YGVVPTF
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.139990.0callus| leaf| panicle| root| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329948390.0
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1096300.0AK109630.1 Oryza sativa Japonica Group cDNA clone:002-138-D02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623284.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 3
TrEMBLA2X1K20.0A2X1K2_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA007657-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38442348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24790.11e-23CONSTANS-like 3